(data stored in SCRATCH zone)

EMBL: AL009126.TLPC

AL009126.TLPC        Location/Qualifiers
FT   CDS             complement(372771..374492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="BSU_03440"
FT                   /old_locus_tag="BSU03440"
FT                   /product="methyl-accepting chemotaxis protein (plant
FT                   colonization)"
FT                   /function="16.3: Control"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7704255, 7921238, 15187186,
FT                   27899502; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12138"
FT                   /db_xref="GOA:P39209"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="SubtiList:BG10790"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39209"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7704255, 7921238, 15187186, 27899502"
FT                   /protein_id="CAB12138.2"
FT                   /translation="MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMA
FT                   TEKAKGDLALSSTYIDDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQ
FT                   GDTRVATNVMKNGERAVGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNG
FT                   NIIGMLYTGANQSILASLTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAF
FT                   ESAGNGDMTIEVSDKTGDELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGA
FT                   EETNQASEKITEAVQQIANGAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLA
FT                   QSKADIGQKEIANVQAQMDAIHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLL
FT                   ALNAAIEAARAGEQGKGFAVVADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEH
FT                   VKTEAAEGVTMIQRTRDAFKEIAAATGEISAEISDLSASVTNISASAHQINDSFAANTA
FT                   DIKESTKNTRQAAALTEEQFAAMEEITAASETLSQLAEELTGIISQFKMINQAENG"
     MLIKRFKMKL GTKILCLVFV VILLFSASVG TVMLKEITES MKQMATEKAK GDLALSSTYI        60
     DDVMSGDWQV KNNKLYKGQT QINGNEDIVD LLGEKTGDTI TIFQGDTRVA TNVMKNGERA       120
     VGTQASSEVI AAVLKKGKRF YGQADVAGSS YQTAYMPLKD QNGNIIGMLY TGANQSILAS       180
     LTQSLFTQFA IVLVIVIMVS VILVLVFTRK INKRLNALKS AFESAGNGDM TIEVSDKTGD       240
     ELSELSVYYN KMRMKLNDTI QTVQQSALQL ASASQQLSAG AEETNQASEK ITEAVQQIAN       300
     GAQDQITRIE NSESSLKQAS ADIRDISANT AAIADKGQLA QSKADIGQKE IANVQAQMDA       360
     IHQSIQKSGE IIHQLDGRSK QIEQILSVIT QIADQTNLLA LNAAIEAARA GEQGKGFAVV       420
     ADEVRKLAEE SQQSAGQISK LIIEIQKDMN RSARSVEHVK TEAAEGVTMI QRTRDAFKEI       480
     AAATGEISAE ISDLSASVTN ISASAHQIND SFAANTADIK ESTKNTRQAA ALTEEQFAAM       540
     EEITAASETL SQLAEELTGI ISQFKMINQA ENG                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page