(data stored in SCRATCH zone)

EMBL: AL009126.TMK

AL009126.TMK         Location/Qualifiers
FT   CDS             39159..39797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BSU_00280"
FT                   /old_locus_tag="BSU00280"
FT                   /product="thymidylate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.4.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9696781, 12682299, 18523102;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11804"
FT                   /db_xref="GOA:P37537"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="SubtiList:BG10092"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37537"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9696781, 12682299, 18523102"
FT                   /protein_id="CAB11804.2"
FT                   /translation="MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPGGIDI
FT                   AEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAY
FT                   QGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLEKLD
FT                   FHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEALKKIQL"
     MSGLFITFEG PEGAGKTTVL QEIKNILTAE GLQVMATREP GGIDIAEQIR EVILNENNIL        60
     MDPKTEALLY AAARRQHLVE KVKPALEQGF IVLCDRFIDS SLAYQGYARG LGIDEVLSIN       120
     EFAIGDMMPH VTVYFSIDPE EGLKRIYANG SREKNRLDLE KLDFHTKVQE GYQELMKRFP       180
     ERFHSVDAGQ SKDLVVQDVL KVIDEALKKI QL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page