(data stored in SCRATCH zone)

EMBL: AL009126.TMRB

AL009126.TMRB        Location/Qualifiers
FT   CDS             complement(339156..339749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmrB"
FT                   /locus_tag="BSU_03140"
FT                   /old_locus_tag="BSU03140"
FT                   /product="ATP-binding tunicamycin resistance protein"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1624425, 7766032, 15131133,
FT                   27315722; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12108"
FT                   /db_xref="GOA:P12921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10456"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12921"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1624425, 7766032, 15131133, 27315722"
FT                   /protein_id="CAB12108.2"
FT                   /translation="MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQ
FT                   EIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVH
FT                   HFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAEN
FT                   IAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK"
     MIIWINGAFG SGKTQTAFEL HRRLNPSYVY DPEKMGFALR SMVPQEIAKD DFQSYPLWRA        60
     FNYSLLASLT DTYRGILIVP MTIVHPEYFN EIIGRLRQEG RIVHHFTLMA SKETLLKRLR       120
     TRAEGKNSWA AKQIDRCVEG LSSPIFEDHI QTDNLSIQDV AENIAARAEL PLDPDTRGSL       180
     RRFADRLMVK LNHIRIK                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page