(data stored in SCRATCH zone)

EMBL: AL009126.TRMNF

AL009126.TRMNF       Location/Qualifiers
FT   CDS             42917..43660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmNF"
FT                   /locus_tag="BSU_00340"
FT                   /old_locus_tag="BSU00340"
FT                   /product="tRNA1(Val) (adenine(37)-N6)-methyltransferase"
FT                   /function="16.3: Control"
FT                   /function="10.3: tRNA and rRNA base modification"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.1.223"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 22905870, 24809820; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11810"
FT                   /db_xref="GOA:P37543"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG10098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37543"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11810.1"
FT                   /translation="MVSLHDDERLDYLLAEDMKIIQSPTVFAFSLDAVLLSKFAYVPIQ
FT                   KGKIVDLCTGNGIVPLLLSTRSKADILGVEIQERLHDMAVRSVEYNKLDDQIQIIHDDL
FT                   KNMPEKLGHNRYDVVTCNPPYFKTPKQTEQNMNEHLRIARHEIHCTLEDVISVSSKLLK
FT                   QGGKAALVHRPGRLLEIFELMKAYQIEPKRVQFVYPKQGKEANTILVEGIKGGRPDLKI
FT                   LPPLFVYDEQNEYTKEIRTILYGDK"
     MVSLHDDERL DYLLAEDMKI IQSPTVFAFS LDAVLLSKFA YVPIQKGKIV DLCTGNGIVP        60
     LLLSTRSKAD ILGVEIQERL HDMAVRSVEY NKLDDQIQII HDDLKNMPEK LGHNRYDVVT       120
     CNPPYFKTPK QTEQNMNEHL RIARHEIHCT LEDVISVSSK LLKQGGKAAL VHRPGRLLEI       180
     FELMKAYQIE PKRVQFVYPK QGKEANTILV EGIKGGRPDL KILPPLFVYD EQNEYTKEIR       240
     TILYGDK                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page