(data stored in SCRATCH zone)

EMBL: AL009126.UBIX

AL009126.UBIX        Location/Qualifiers
FT   CDS             412540..413154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="BSU_03630"
FT                   /old_locus_tag="BSU03630"
FT                   /product="phenolic acid decarboxylase-flavin
FT                   prenyltransferase subunit"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 10919793, 15979273,
FT                   17295427, 18388975, 26083743, 26658822, 26337367; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12157"
FT                   /db_xref="GOA:P94404"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR032901"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="SubtiList:BG12023"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94404"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12157.1"
FT                   /translation="MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLV
FT                   VSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLAS
FT                   IRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFY
FT                   NRPRSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA"
     MKAEFKRKGG GKVKLVVGMT GATGAIFGVR LLQWLKAAGV ETHLVVSPWA NVTIKHETGY        60
     TLQEVEQLAT YTYSHKDQAA AISSGSFDTD GMIVAPCSMK SLASIRTGMA DNLLTRAADV       120
     MLKERKKLVL LTRETPLNQI HLENMLALTK MGTIILPPMP AFYNRPRSLE EMVDHIVFRT       180
     LDQFGIRLPE AKRWNGIEKQ KGGA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page