(data stored in SCRATCH zone)

EMBL: AL009126.VEG

AL009126.VEG         Location/Qualifiers
FT   CDS             52763..53023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="BSU_00440"
FT                   /old_locus_tag="BSU00440"
FT                   /product="conserved hypothetical protein"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12761295, 22720735, 23378512; Product
FT                   type ph: phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11820"
FT                   /db_xref="GOA:P37466"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="SubtiList:BG10107"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37466"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11820.1"
FT                   /translation="MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELTFNDDAASSVAF"
     MAKTLSDIKR SLDGNLGKRL TLKANGGRRK TIERSGILAE TYPSVFVIQL DQDENSFERV        60
     SYSYADILTE TVELTFNDDA ASSVAF                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page