(data stored in ACNUC7421 zone)

EMBL: AL009126.XPAC

AL009126.XPAC        Location/Qualifiers
FT   CDS             35845..36459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xpaC"
FT                   /locus_tag="BSU_00250"
FT                   /old_locus_tag="BSU00250"
FT                   /product="putative phosphatase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.3: Control"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 23155385; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00250"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11801"
FT                   /db_xref="GOA:P37467"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="SubtiList:BG10089"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37467"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11801.1"
FT                   /translation="MQRFFHFLVWSLTSSATFVFIGILSFFGLNQSIFLSIVYGLASGA
FT                   AVYIAGIWNARRLFLKKHELTGREYAYIKKNLEEARQKMVRLRKALFQAKSIQMFKQNA
FT                   EMLRIVRRIYLLTKKEPKRFYQAERFFYQTLDSVVELTEKYAFLSSHPKKSKELSMSLS
FT                   ETRITLTELTKRLEEDLTQAMGDEIDELQFELDAAKHSLKK"
     MQRFFHFLVW SLTSSATFVF IGILSFFGLN QSIFLSIVYG LASGAAVYIA GIWNARRLFL        60
     KKHELTGREY AYIKKNLEEA RQKMVRLRKA LFQAKSIQMF KQNAEMLRIV RRIYLLTKKE       120
     PKRFYQAERF FYQTLDSVVE LTEKYAFLSS HPKKSKELSM SLSETRITLT ELTKRLEEDL       180
     TQAMGDEIDE LQFELDAAKH SLKK                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page