(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAC

AL009126.YAAC        Location/Qualifiers
FT   CDS             complement(14847..15794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaC"
FT                   /locus_tag="BSU_00080"
FT                   /old_locus_tag="BSU00080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11784"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="SubtiList:BG10072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37526"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11784.1"
FT                   /translation="MTYHEWKDLALFYSVESTQKFLEKVYILNGINDAKKNSFKNSERF
FT                   IYFLKHAESFYKQAAYSPLEIKPILLFYGMAQLIKACLITRDPHYPSHTSVLAHGVTTR
FT                   KRKKQNYCFSDDEVKIQRNGLCVHFMKHLFGQSDIVDERYTMKKLLMAIPELSDIFYFQ
FT                   QKERFMTKVEKDKNEIFVPEEVVINYKMSDSRFAEYMSHHYQWSFTKKNEHGLLFEISP
FT                   QDKEPWTSTSLLFDMEKNQYYIPSQREQFLRLPEMTIHYLILYNVGMIARYETEWWYEL
FT                   LTQHISDDYVLIQQFLLVSEKKFPKYASQFLLHF"
     MTYHEWKDLA LFYSVESTQK FLEKVYILNG INDAKKNSFK NSERFIYFLK HAESFYKQAA        60
     YSPLEIKPIL LFYGMAQLIK ACLITRDPHY PSHTSVLAHG VTTRKRKKQN YCFSDDEVKI       120
     QRNGLCVHFM KHLFGQSDIV DERYTMKKLL MAIPELSDIF YFQQKERFMT KVEKDKNEIF       180
     VPEEVVINYK MSDSRFAEYM SHHYQWSFTK KNEHGLLFEI SPQDKEPWTS TSLLFDMEKN       240
     QYYIPSQREQ FLRLPEMTIH YLILYNVGMI ARYETEWWYE LLTQHISDDY VLIQQFLLVS       300
     EKKFPKYASQ FLLHF                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page