(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAI

AL009126.YAAI        Location/Qualifiers
FT   CDS             complement(25221..25766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="BSU_00170"
FT                   /old_locus_tag="BSU00170"
FT                   /product="putative amidase (isochorismatase family)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 2521622; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11793"
FT                   /db_xref="GOA:P37532"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="SubtiList:BG10081"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37532"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11793.1"
FT                   /translation="MSKADKALLIVDMINNFEFDMGETLAKKTEKIVPHILSLKEHARQ
FT                   NEWPIIYINDHYGLWQADIKNIQQECTNERSKDIITKIAPVDADYFLIKPKHSAFYETA
FT                   LHTLLTELQVRHIIITGIAGNICVLFTANDAYMREYSITIPKDCIASNSDEDNEFALTM
FT                   MENVLFAEITTEEQIIEK"
     MSKADKALLI VDMINNFEFD MGETLAKKTE KIVPHILSLK EHARQNEWPI IYINDHYGLW        60
     QADIKNIQQE CTNERSKDII TKIAPVDADY FLIKPKHSAF YETALHTLLT ELQVRHIIIT       120
     GIAGNICVLF TANDAYMREY SITIPKDCIA SNSDEDNEFA LTMMENVLFA EITTEEQIIE       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page