(data stored in SCRATCH zone)

EMBL: AL009126.YAAL

AL009126.YAAL        Location/Qualifiers
FT   CDS             29481..29705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaL"
FT                   /locus_tag="BSU_00220"
FT                   /old_locus_tag="BSU00220"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00220"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11798"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="SubtiList:BG10086"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37533"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11798.1"
FT                   /translation="MGFLRKKTLRREFDEKLTEQLFKQKEEWNRQKKLVEKSLEPSAEV
FT                   LYELKVAEAKYFFYLREAKQRNLKISRWK"
     MGFLRKKTLR REFDEKLTEQ LFKQKEEWNR QKKLVEKSLE PSAEVLYELK VAEAKYFFYL        60
     REAKQRNLKI SRWK                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page