(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAO

AL009126.YAAO        Location/Qualifiers
FT   CDS             37720..39162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaO"
FT                   /locus_tag="BSU_00270"
FT                   /old_locus_tag="BSU00270"
FT                   /product="putative decarboxylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9723923, 20876533,
FT                   24529384; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11803"
FT                   /db_xref="GOA:P37536"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="SubtiList:BG10091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37536"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11803.1"
FT                   /translation="MNTPLYKALIQHARRNSHSFHVPGHHNGDVFFDDAKSIFDPLLTI
FT                   DVTELAGLDDLHHPSGVIKEAQELASQLYGSAESFFLVNGTTVGNLAMILSVCEPGDTI
FT                   LVQRNCHKSVFHAVDLSGAEPVYLAPDVDSAMHVPTHVPLGTIKEALEAYPDAKGLVLT
FT                   NPTYYGHSADLTEIITEAHHYGIPVLVDEAHGAHFILGEPFPVSALKMGADIVVQSAHK
FT                   TLPAMTMGSYLHLNSSCRINRDRVAEYLNRLQSSSPSYPIMASLDIARAYVQHIIEEQK
FT                   LSDILQRIETLKQTFDSLTNAEAVNPANPLIITDPLKLTIRSKRGHSGYTLQSILERAN
FT                   IFTELADENQVLLVLPLGGKRRINAEIIRSIDEEIEKTPPDQTFVSAEWGVQPVTVLPY
FT                   PKKVLHSFKKEYVSFEEAAGRLNAEDIIPYPPGIPMIMAGERITKESVQKLSRLISMKT
FT                   HVQGNMKIKEKQLLVYIEEEKS"
     MNTPLYKALI QHARRNSHSF HVPGHHNGDV FFDDAKSIFD PLLTIDVTEL AGLDDLHHPS        60
     GVIKEAQELA SQLYGSAESF FLVNGTTVGN LAMILSVCEP GDTILVQRNC HKSVFHAVDL       120
     SGAEPVYLAP DVDSAMHVPT HVPLGTIKEA LEAYPDAKGL VLTNPTYYGH SADLTEIITE       180
     AHHYGIPVLV DEAHGAHFIL GEPFPVSALK MGADIVVQSA HKTLPAMTMG SYLHLNSSCR       240
     INRDRVAEYL NRLQSSSPSY PIMASLDIAR AYVQHIIEEQ KLSDILQRIE TLKQTFDSLT       300
     NAEAVNPANP LIITDPLKLT IRSKRGHSGY TLQSILERAN IFTELADENQ VLLVLPLGGK       360
     RRINAEIIRS IDEEIEKTPP DQTFVSAEWG VQPVTVLPYP KKVLHSFKKE YVSFEEAAGR       420
     LNAEDIIPYP PGIPMIMAGE RITKESVQKL SRLISMKTHV QGNMKIKEKQ LLVYIEEEKS       480
//

If you have problems or comments...

PBIL Back to PBIL home page