(data stored in ACNUC7421 zone)

EMBL: AL009126.YAAR

AL009126.YAAR        Location/Qualifiers
FT   CDS             40213..40653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="BSU_00300"
FT                   /old_locus_tag="BSU00300"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 22333191, 22720735"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11806"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="SubtiList:BG10094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37539"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11806.1"
FT                   /translation="MKINKDIRTFIDNKQIPSVKTSEITASFKTSMENQSSKMKLDQLT
FT                   RLLSDIEAFGKRLTKSRNFKDLARFKGLVKRFVKEAVDSGLSHETSKSFDLYGNSRTLG
FT                   LVKEIDDKLIQLTEEMMDQEKPAIDLLERIGEIKGLLINLYT"
     MKINKDIRTF IDNKQIPSVK TSEITASFKT SMENQSSKMK LDQLTRLLSD IEAFGKRLTK        60
     SRNFKDLARF KGLVKRFVKE AVDSGLSHET SKSFDLYGNS RTLGLVKEID DKLIQLTEEM       120
     MDQEKPAIDL LERIGEIKGL LINLYT                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page