(data stored in ACNUC7421 zone)

EMBL: AL009126.YABE

AL009126.YABE        Location/Qualifiers
FT   CDS             48629..49942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabE"
FT                   /locus_tag="BSU_00400"
FT                   /old_locus_tag="BSU00400"
FT                   /product="putative cell wall shaping enzyme"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15774001, 19047346;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00400"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11816"
FT                   /db_xref="GOA:P37546"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="SubtiList:BG10103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37546"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11816.1"
FT                   /translation="MGEREGRVDSLLDTLYNLSEEKEAFFITQKMKKLFSVKLSKSKVI
FT                   LVAACLLLAGSGTAYAAHELTKQSVSVSINGKKKHIRTHANTVGDLLETLDIKTRDEDK
FT                   ITPAKQTKITADMDVVYEAAKPVKLTINGEEKTLWSTAKTVGALLDEQDVDVKEQDQID
FT                   PAIDTDISKDMKINIEPAFQVTVNDAGKQKKIWTTSTTVADFLKQQKMNIKDEDKIKPA
FT                   LDAKLTKGKADITITRIEKVTDVVEEKIAFDVKKQEDASLEKGKEKVVQKGKEGKLKKH
FT                   FEVVKENGKEVSRELVKEETAEQSKDKVIAVGTKQSSPKFETVSASGDSKTVVSRSNES
FT                   TGKVMTVSSTAYTASCSGCSGHTATGVNLKNNPNAKVIAVDPNVIPLGSKVHVEGYGYA
FT                   IAADTGSAIKGNKIDVFFPEKSSAYRWGNKTVKIKILN"
     MGEREGRVDS LLDTLYNLSE EKEAFFITQK MKKLFSVKLS KSKVILVAAC LLLAGSGTAY        60
     AAHELTKQSV SVSINGKKKH IRTHANTVGD LLETLDIKTR DEDKITPAKQ TKITADMDVV       120
     YEAAKPVKLT INGEEKTLWS TAKTVGALLD EQDVDVKEQD QIDPAIDTDI SKDMKINIEP       180
     AFQVTVNDAG KQKKIWTTST TVADFLKQQK MNIKDEDKIK PALDAKLTKG KADITITRIE       240
     KVTDVVEEKI AFDVKKQEDA SLEKGKEKVV QKGKEGKLKK HFEVVKENGK EVSRELVKEE       300
     TAEQSKDKVI AVGTKQSSPK FETVSASGDS KTVVSRSNES TGKVMTVSST AYTASCSGCS       360
     GHTATGVNLK NNPNAKVIAV DPNVIPLGSK VHVEGYGYAI AADTGSAIKG NKIDVFFPEK       420
     SSAYRWGNKT VKIKILN                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page