(data stored in ACNUC7421 zone)

EMBL: AL009126.YABN

AL009126.YABN        Location/Qualifiers
FT   CDS             66405..67874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabN"
FT                   /locus_tag="BSU_00580"
FT                   /old_locus_tag="BSU00580"
FT                   /product="putative fusion methylase and nucleotide
FT                   pyrophosphohydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11178267; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00580"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11834"
FT                   /db_xref="GOA:P37556"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="SubtiList:BG10121"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37556"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11834.1"
FT                   /translation="MAGKITVVGLGAGDMDQLTIGIHKLLTKADTLYVRTKDHPLIEEL
FT                   EKETKNIRFFDDIYEKHDQFEAVYEEIADILFEAARREDVVYAVPGHPFVAEKTVQLLT
FT                   ERQEKENVQVKVAGGQSFLDATFNVLQIDPIEGFQFVDAGTLSADELELRHHLIICQVY
FT                   DQMTASEVKLTLMEKLPDDYEVVIVTAAGSRGEEIRTVPLFELDRNVALNNLTSVYIPP
FT                   IKEEKLLYHEFSTFRSIIRELRGPNGCPWDKKQTHQSLKQYMIEECYELLEAIDEEDTD
FT                   HMIEELGDVLLQVLLHAQIGEDEGYFTIDDVIKGISEKMVRRHPHVFKDVKVQDENDVL
FT                   ANWEDIKKAEKNTSESSLLDSVPKTLPALSKAAKLQKKAAKVGFDWEDVSDIWEKVSEE
FT                   MKEFSSEVSEAPHEHNLKAEFGDILFALVNVARFYKIEPEEALTMTNDKFRRRFSYIEE
FT                   TAKEEGVELADMSLEDMDKLWNEAKETERRS"
     MAGKITVVGL GAGDMDQLTI GIHKLLTKAD TLYVRTKDHP LIEELEKETK NIRFFDDIYE        60
     KHDQFEAVYE EIADILFEAA RREDVVYAVP GHPFVAEKTV QLLTERQEKE NVQVKVAGGQ       120
     SFLDATFNVL QIDPIEGFQF VDAGTLSADE LELRHHLIIC QVYDQMTASE VKLTLMEKLP       180
     DDYEVVIVTA AGSRGEEIRT VPLFELDRNV ALNNLTSVYI PPIKEEKLLY HEFSTFRSII       240
     RELRGPNGCP WDKKQTHQSL KQYMIEECYE LLEAIDEEDT DHMIEELGDV LLQVLLHAQI       300
     GEDEGYFTID DVIKGISEKM VRRHPHVFKD VKVQDENDVL ANWEDIKKAE KNTSESSLLD       360
     SVPKTLPALS KAAKLQKKAA KVGFDWEDVS DIWEKVSEEM KEFSSEVSEA PHEHNLKAEF       420
     GDILFALVNV ARFYKIEPEE ALTMTNDKFR RRFSYIEETA KEEGVELADM SLEDMDKLWN       480
     EAKETERRS                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page