(data stored in ACNUC7421 zone)

EMBL: AL009126.YABR

AL009126.YABR        Location/Qualifiers
FT   CDS             69626..70012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabR"
FT                   /locus_tag="BSU_00630"
FT                   /old_locus_tag="BSU00630"
FT                   /product="putative RNA degradation protein;
FT                   polyribonucleotide nucleotidyltransferase or phosphorylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 9862121, 15066026,
FT                   16014871, 22720735; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00630"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11839"
FT                   /db_xref="GOA:P37560"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="SubtiList:BG10126"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37560"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11839.1"
FT                   /translation="MSIEVGSKLQGKITGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKDRPQARPRNDFRPKESFEQKMNKFLKD
FT                   SEDRLSSLKRNTESKRGGRGARRG"
     MSIEVGSKLQ GKITGITNFG AFVELPGGST GLVHISEVAD NYVKDINDHL KVGDQVEVKV        60
     INVEKDGKIG LSIKKAKDRP QARPRNDFRP KESFEQKMNK FLKDSEDRLS SLKRNTESKR       120
     GGRGARRG                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page