(data stored in SCRATCH zone)

EMBL: AL009126.YABS

AL009126.YABS        Location/Qualifiers
FT   CDS             73106..73843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabS"
FT                   /locus_tag="BSU_00650"
FT                   /old_locus_tag="BSU00650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11841"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="SubtiList:BG10128"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37561"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11841.1"
FT                   /translation="MNNGHLNQILLITDGCSNHGEDPLAMAAFAKEQGITVNVIGIMEE
FT                   NQIDPEAMKEVEGIALAGGGVHQVVYASQLSQTVQMVTKKAMTQTLQGVVNQELKQILG
FT                   KNVEMEELSPEKRGEVMEVVDELGETVHLQVLVLVDTSASMAPKLPTVKEALIDLSVSL
FT                   NSRIGNNEFAMCIFPGKKQEVELVLNWTPKLQSLSTLFAKLSTGGITPTGPAIREATLQ
FT                   FEKIRSRRGMLADDERRFDEFGM"
     MNNGHLNQIL LITDGCSNHG EDPLAMAAFA KEQGITVNVI GIMEENQIDP EAMKEVEGIA        60
     LAGGGVHQVV YASQLSQTVQ MVTKKAMTQT LQGVVNQELK QILGKNVEME ELSPEKRGEV       120
     MEVVDELGET VHLQVLVLVD TSASMAPKLP TVKEALIDLS VSLNSRIGNN EFAMCIFPGK       180
     KQEVELVLNW TPKLQSLSTL FAKLSTGGIT PTGPAIREAT LQFEKIRSRR GMLADDERRF       240
     DEFGM                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page