(data stored in ACNUC7421 zone)

EMBL: AL009126.YACD

AL009126.YACD        Location/Qualifiers
FT   CDS             80802..81695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacD"
FT                   /locus_tag="BSU_00720"
FT                   /old_locus_tag="BSU00720"
FT                   /product="putative protein chaperone accessory lipoprotein
FT                   factor"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15187182, 15856219;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11848"
FT                   /db_xref="GOA:P37566"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="SubtiList:BG10135"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37566"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11848.1"
FT                   /translation="MKSRTIWTIILGALLVCCIAVAYTLTKSQAGASSSGESIATIGGK
FT                   SVTREEWLKEMEDQYGKSTLEDMINVRVVEQLAKKNKLKISKSEVDREFLLIKAVNNSF
FT                   YEDEHTTEKEWKDQIRYNILLEDLLTRDIDISNKELESFYNKNKELYQFDDSYRIRHIV
FT                   VKDEEEAREVLKELKGGSSFEAVAAERSTDRYTSPYGGDLGFVTEASDNIPSAYIEEAK
FT                   TLKEDEWSQEPIKVSNGYAIIQLKEKLKARTFSFDEVKDQIRRQIAMDQLGDKATVKTL
FT                   WKEADVSWFYGEKSTK"
     MKSRTIWTII LGALLVCCIA VAYTLTKSQA GASSSGESIA TIGGKSVTRE EWLKEMEDQY        60
     GKSTLEDMIN VRVVEQLAKK NKLKISKSEV DREFLLIKAV NNSFYEDEHT TEKEWKDQIR       120
     YNILLEDLLT RDIDISNKEL ESFYNKNKEL YQFDDSYRIR HIVVKDEEEA REVLKELKGG       180
     SSFEAVAAER STDRYTSPYG GDLGFVTEAS DNIPSAYIEE AKTLKEDEWS QEPIKVSNGY       240
     AIIQLKEKLK ARTFSFDEVK DQIRRQIAMD QLGDKATVKT LWKEADVSWF YGEKSTK          297
//

If you have problems or comments...

PBIL Back to PBIL home page