(data stored in ACNUC7421 zone)

EMBL: AL009126.YACL

AL009126.YACL        Location/Qualifiers
FT   CDS             108674..109774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BSU_00890"
FT                   /old_locus_tag="BSU00890"
FT                   /product="putative membrane protein possibly involved in
FT                   RNA binding"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 26999498; Product type
FT                   m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11865"
FT                   /db_xref="GOA:Q06754"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="SubtiList:BG10151"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06754"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11865.1"
FT                   /translation="MLKRIVQAFFIIFGGVVGIFLIPELFVLLNIQDIPLITNAYTSAA
FT                   IGAIIFFLISIWGTEYVVNWVKWIEDSLLKAPVPDLLFGSLGLVFGLIIAYLIVNVIPL
FT                   DNIPYRIFSTIIPVFLAFFLGYLGFQVGFKKKDELISLFSISARMQKKKGTADEEHEVQ
FT                   DKKLKILDTSVIIDGRIADICQTGFLEGVIVIPQFVLEELQHIADSSDVLKRNRGRRGL
FT                   DILNRIQKELDIEVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVA
FT                   VLNINDLANAVKPVVLPGEEMNVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKHID
FT                   VLVTSVLQTAAGRMIFAKPKLLEKAL"
     MLKRIVQAFF IIFGGVVGIF LIPELFVLLN IQDIPLITNA YTSAAIGAII FFLISIWGTE        60
     YVVNWVKWIE DSLLKAPVPD LLFGSLGLVF GLIIAYLIVN VIPLDNIPYR IFSTIIPVFL       120
     AFFLGYLGFQ VGFKKKDELI SLFSISARMQ KKKGTADEEH EVQDKKLKIL DTSVIIDGRI       180
     ADICQTGFLE GVIVIPQFVL EELQHIADSS DVLKRNRGRR GLDILNRIQK ELDIEVEIYE       240
     GDFEDIQEVD SKLVKLAKLT SGVVVTNDFN LNKVCELQKV AVLNINDLAN AVKPVVLPGE       300
     EMNVQVIKDG KEHNQGVAYL DDGTMIVVEE GRNYIGKHID VLVTSVLQTA AGRMIFAKPK       360
     LLEKAL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page