(data stored in SCRATCH zone)

EMBL: AL009126.YAZA

AL009126.YAZA        Location/Qualifiers
FT   CDS             43647..43946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yazA"
FT                   /locus_tag="BSU_00350"
FT                   /old_locus_tag="BSU00350"
FT                   /product="putative UvrC-Intron-type (URI) endonuclease"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 11483577; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11811"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="SubtiList:BG12700"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31414"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11811.1"
FT                   /translation="METNNHFFYVVKCKDNSWYAGYTNDLHKRVKTHNDGKGAKYTKVR
FT                   RPVELIFAESFSTKREAMQAEYYFKKLTRKKKELYIEEKRNSKEAVYVKAPNEL"
     METNNHFFYV VKCKDNSWYA GYTNDLHKRV KTHNDGKGAK YTKVRRPVEL IFAESFSTKR        60
     EAMQAEYYFK KLTRKKKELY IEEKRNSKEA VYVKAPNEL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page