(data stored in SCRATCH zone)

EMBL: AL009126.YBAC

AL009126.YBAC        Location/Qualifiers
FT   CDS             134171..135127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaC"
FT                   /locus_tag="BSU_01140"
FT                   /old_locus_tag="BSU01140"
FT                   /product="putative proline iminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.5"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11890"
FT                   /db_xref="GOA:P70981"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11988"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11890.2"
FT                   /translation="MIPEKKSIAIMKELSIGNTKQMLMINGVDVKNPLLLFLHGGPGTP
FT                   QIGYVRHYQKELEQYFTVVHWDQRGSGLSYSKRISHHSMTINHFIKDTIQVTQWLLAHF
FT                   SKSKLYLAGHSWGSILALHVLQQRPDLFYTYYGISQVVNPQDEESTAYQHIREISESKK
FT                   ASILSFLTRFIGAPPWKQDIQHLIYRFCVELTRGGFTHRHRQSLAVLFQMLTGNEYGVR
FT                   NMHSFLNGLRFSKKHLTDELYRFNAFTSVPSIKVPCVFISGKHDLIVPAEISKQYYQEL
FT                   EAPEKRWFQFENSAHTPHIEEPSLFANTLSRHARHHL"
     MIPEKKSIAI MKELSIGNTK QMLMINGVDV KNPLLLFLHG GPGTPQIGYV RHYQKELEQY        60
     FTVVHWDQRG SGLSYSKRIS HHSMTINHFI KDTIQVTQWL LAHFSKSKLY LAGHSWGSIL       120
     ALHVLQQRPD LFYTYYGISQ VVNPQDEEST AYQHIREISE SKKASILSFL TRFIGAPPWK       180
     QDIQHLIYRF CVELTRGGFT HRHRQSLAVL FQMLTGNEYG VRNMHSFLNG LRFSKKHLTD       240
     ELYRFNAFTS VPSIKVPCVF ISGKHDLIVP AEISKQYYQE LEAPEKRWFQ FENSAHTPHI       300
     EEPSLFANTL SRHARHHL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page