(data stored in ACNUC7421 zone)

EMBL: AL009126.YBAJ

AL009126.YBAJ        Location/Qualifiers
FT   CDS             155156..155923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="BSU_01510"
FT                   /old_locus_tag="BSU01510"
FT                   /product="putative methyltransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 26582911; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11927"
FT                   /db_xref="GOA:P70976"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="SubtiList:BG11994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70976"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11927.2"
FT                   /translation="MNALVAHNSKAWDKKVETGNEWTVAVEQQVIEQAKKGNWDIRVTP
FT                   MKDVPKDWFPPIKGLKVLCLASGGGQQGPVLAAAGADVTVLDNSEKQLNQDRMIAERDG
FT                   LTIHTVKGSMDDLSVFNDESFDVIVHPVANVFVENVLPVWKEAYRVLKRNGILISGFVN
FT                   PVVFLFDTELEQQGVLKVKHSIPYADPEDLPKHKVKKLIENNEALEFGHSLEDQIKGQI
FT                   DAGFIVTGFYEDKGGFVLDQYIHTYSATRSVKV"
     MNALVAHNSK AWDKKVETGN EWTVAVEQQV IEQAKKGNWD IRVTPMKDVP KDWFPPIKGL        60
     KVLCLASGGG QQGPVLAAAG ADVTVLDNSE KQLNQDRMIA ERDGLTIHTV KGSMDDLSVF       120
     NDESFDVIVH PVANVFVENV LPVWKEAYRV LKRNGILISG FVNPVVFLFD TELEQQGVLK       180
     VKHSIPYADP EDLPKHKVKK LIENNEALEF GHSLEDQIKG QIDAGFIVTG FYEDKGGFVL       240
     DQYIHTYSAT RSVKV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page