(data stored in ACNUC7421 zone)

EMBL: AL009126.YBAK

AL009126.YBAK        Location/Qualifiers
FT   CDS             156109..156552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="BSU_01520"
FT                   /old_locus_tag="BSU01520"
FT                   /product="conserved protein of unknown function"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 14679227, 16267290"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11928"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="SubtiList:BG11503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50862"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11928.1"
FT                   /translation="MAEVLSFMDVKRQKDFELEKNLLKELSLRQIIQSVKDCLEPLFPF
FT                   LHDERDIITEGCIDFAIEAYLLGGRFGIFGYYGESMQSISARSAREEEELRMEFFDYLY
FT                   NWIHEQYATFDKNTVYEAARKFIKDWWTAGFVQREKQCKLRMR"
     MAEVLSFMDV KRQKDFELEK NLLKELSLRQ IIQSVKDCLE PLFPFLHDER DIITEGCIDF        60
     AIEAYLLGGR FGIFGYYGES MQSISARSAR EEEELRMEFF DYLYNWIHEQ YATFDKNTVY       120
     EAARKFIKDW WTAGFVQREK QCKLRMR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page