(data stored in ACNUC7421 zone)

EMBL: AL009126.YBBC

AL009126.YBBC        Location/Qualifiers
FT   CDS             complement(185194..186438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="BSU_01650"
FT                   /old_locus_tag="BSU01650"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11941"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="SubtiList:BG10833"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11941.1"
FT                   /translation="MRKTIFAFLTGLMMFGTITAASASPDSKNQTAKKPKVQTGIDTLL
FT                   PDYKKQLKGKRIGLITNPAGVNTSLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDE
FT                   VGSYIDEKTGVPVYSLYGKTKKPTPEMLKNVDILMFDIQDVGTRFYTYIYTMAYAMEAA
FT                   KENGIPFMVLDRPNPQGGNHIEGPILEPEYASFVGLYPIPLKHGMTIGELASLFNKEFS
FT                   IDADLTVVKMKHWKRKMDFDDTRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEGRGT
FT                   TKPFELIGAPFIKSTELEETLNSLHLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRD
FT                   KFEAVKTGLSVIKTIHDLYPEDFEFLSTGSFDKLAGNGWIRTKIENGTSVENIINSYEK
FT                   TLQQFSKTRKKYLIY"
     MRKTIFAFLT GLMMFGTITA ASASPDSKNQ TAKKPKVQTG IDTLLPDYKK QLKGKRIGLI        60
     TNPAGVNTSL KSSVDILYEN PDIKLTALFG PEHGVRGDAQ AGDEVGSYID EKTGVPVYSL       120
     YGKTKKPTPE MLKNVDILMF DIQDVGTRFY TYIYTMAYAM EAAKENGIPF MVLDRPNPQG       180
     GNHIEGPILE PEYASFVGLY PIPLKHGMTI GELASLFNKE FSIDADLTVV KMKHWKRKMD       240
     FDDTRLPFVL PSPNMPTVES TFVYPATGLI EGTNISEGRG TTKPFELIGA PFIKSTELEE       300
     TLNSLHLPGV TFRAASFTPT FSKHQGTLCH GVQLYVTDRD KFEAVKTGLS VIKTIHDLYP       360
     EDFEFLSTGS FDKLAGNGWI RTKIENGTSV ENIINSYEKT LQQFSKTRKK YLIY             414
//

If you have problems or comments...

PBIL Back to PBIL home page