(data stored in ACNUC7421 zone)

EMBL: AL009126.YBBJ

AL009126.YBBJ        Location/Qualifiers
FT   CDS             complement(193075..193557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="BSU_01710"
FT                   /old_locus_tag="BSU01710"
FT                   /product="putative acyltransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11947"
FT                   /db_xref="GOA:Q45583"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="SubtiList:BG11571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45583"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11947.2"
FT                   /translation="MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQ
FT                   DRYPVVILKDDLPVGFFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLL
FT                   LPAFVSGYFPWCDEIILAVNHLNIRAKHLYMKSGFLDKGRRRIGPLGEQLILHHFL"
     MTQDISLSFY KPEHLPELQS FTLTNDDKRF TSLPKEVLSQ ALGIQDRYPV VILKDDLPVG        60
     FFILHASKET LASYSNNPFA LLLSSLSLTA VHHGKGYAKK AMLLLPAFVS GYFPWCDEII       120
     LAVNHLNIRA KHLYMKSGFL DKGRRRIGPL GEQLILHHFL                             160
//

If you have problems or comments...

PBIL Back to PBIL home page