(data stored in ACNUC7421 zone)

EMBL: AL009126.YBBK

AL009126.YBBK        Location/Qualifiers
FT   CDS             complement(193570..194025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="BSU_01720"
FT                   /old_locus_tag="BSU01720"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11948"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="SubtiList:BG11572"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45584"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11948.2"
FT                   /translation="MILVSSCLGGIECRYNGSHAASEKIRKLVDEKKAVMACPELLGGF
FT                   STPREPAEIIGGTGEDVLNGTAKIVTASGEDVTELYMEGAAKTLAYAKEINASAVILKE
FT                   NSPSCGSGFIYNGTFSGKKITGSGVTAALLKQAGYRVISENELNDIL"
     MILVSSCLGG IECRYNGSHA ASEKIRKLVD EKKAVMACPE LLGGFSTPRE PAEIIGGTGE        60
     DVLNGTAKIV TASGEDVTEL YMEGAAKTLA YAKEINASAV ILKENSPSCG SGFIYNGTFS       120
     GKKITGSGVT AALLKQAGYR VISENELNDI L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page