(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCC

AL009126.YBCC        Location/Qualifiers
FT   CDS             206941..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /locus_tag="BSU_01845"
FT                   /old_locus_tag="BSU01845"
FT                   /product="conserved transmembrane protein coupled to
FT                   NADH-ubiquinone oxidoreductase chain 5 homolog; prophage 1
FT                   region"
FT                   /function="18: Unknown function"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01845"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11960"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="SubtiList:BG12706"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34688"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11960.2"
FT                   /translation="MGITSVLTKDNVKKIDTDIDVQERDLNVFITSASRVIAPLWPIST
FT                   FAARNPWMGLENQPFDQVASWLKNTRDVDIYPSASMIRSAKNKGEIDEDFVEMGLQRWL
FT                   DSHSYHIPRDVAERFCHAALKLDPLPSDLLSSHELEKLVSECSGLDHIENVFMQPLSSY
FT                   IENQDGERLVNILDHHVIKWSKLYLDDSQAGWTMPNREEGFYRAWQHLIQYDPALSKKQ
FT                   RERVKGWPKEAHLALQEALFALEIPESEIQTYLEGHLLSLPGWAGMMLWRSQQSSHEHA
FT                   LLTEYLAVRISMEWALIKPYLPLTNERSKKTISIAPLIAAWIHWGGLTLEEWSQMTASE
FT                   QNEYLSFAYSFDEKLRKKLWLEAWEQTYTDRLSQKIISKQRETGREKSALAQLAFCIDV
FT                   RSEPFRRQLEKEGPFETIGIAGFFGVPIATCELGSKHSHASLPIIQKPQNKIKEFADED
FT                   VFKKYNQRKQAIHSLSHTFKTMKQNALSSLLLPELSGPWLTLQMAARSFVPRKAGRFIR
FT                   NLREAWLRKPDTKLSLHHDATEAEIPVGFTDEEKVNYARQALKMMGLTENIAPLVVICG
FT                   HGSQSTNNPYSAALDCGACGGAAGGFNARVLAALCNLSEVREALLAEGIKIPEDTVFAA
FT                   AEHNTTVDELHWLYVPELSEAAQEAFEQIEAVMPKVRHHVNAERLAQLPNFQSKLKNPK
FT                   AEANRFAEDWSEIRPEWGLARNAAFIIGKRELTQDCDLEGRAFLHNYDWKQDESGELLA
FT                   NIIVGPGTVAQWINLQYYASTVAPHYYGSGNKATQTVTAGLGVMQGNASDLLAGLPWQS
FT                   VMESDHEAYHSPLRLLILIQAPREYVERLLNHDSAFLQKVQNGWVRLASLDPEGCWESW
FT                   "
     MGITSVLTKD NVKKIDTDID VQERDLNVFI TSASRVIAPL WPISTFAARN PWMGLENQPF        60
     DQVASWLKNT RDVDIYPSAS MIRSAKNKGE IDEDFVEMGL QRWLDSHSYH IPRDVAERFC       120
     HAALKLDPLP SDLLSSHELE KLVSECSGLD HIENVFMQPL SSYIENQDGE RLVNILDHHV       180
     IKWSKLYLDD SQAGWTMPNR EEGFYRAWQH LIQYDPALSK KQRERVKGWP KEAHLALQEA       240
     LFALEIPESE IQTYLEGHLL SLPGWAGMML WRSQQSSHEH ALLTEYLAVR ISMEWALIKP       300
     YLPLTNERSK KTISIAPLIA AWIHWGGLTL EEWSQMTASE QNEYLSFAYS FDEKLRKKLW       360
     LEAWEQTYTD RLSQKIISKQ RETGREKSAL AQLAFCIDVR SEPFRRQLEK EGPFETIGIA       420
     GFFGVPIATC ELGSKHSHAS LPIIQKPQNK IKEFADEDVF KKYNQRKQAI HSLSHTFKTM       480
     KQNALSSLLL PELSGPWLTL QMAARSFVPR KAGRFIRNLR EAWLRKPDTK LSLHHDATEA       540
     EIPVGFTDEE KVNYARQALK MMGLTENIAP LVVICGHGSQ STNNPYSAAL DCGACGGAAG       600
     GFNARVLAAL CNLSEVREAL LAEGIKIPED TVFAAAEHNT TVDELHWLYV PELSEAAQEA       660
     FEQIEAVMPK VRHHVNAERL AQLPNFQSKL KNPKAEANRF AEDWSEIRPE WGLARNAAFI       720
     IGKRELTQDC DLEGRAFLHN YDWKQDESGE LLANIIVGPG TVAQWINLQY YASTVAPHYY       780
     GSGNKATQTV TAGLGVMQGN ASDLLAGLPW QSVMESDHEA YHSPLRLLIL IQAPREYVER       840
     LLNHDSAFLQ KVQNGWVRLA SLDPEGCWES W                                      871
//

If you have problems or comments...

PBIL Back to PBIL home page