(data stored in SCRATCH zone)

EMBL: AL009126.YBCF

AL009126.YBCF        Location/Qualifiers
FT   CDS             209633..210160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="BSU_01860"
FT                   /old_locus_tag="BSU01860"
FT                   /product="putative enzyme; prophage 1 region"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11962"
FT                   /db_xref="GOA:O34823"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="SubtiList:BG12708"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11962.1"
FT                   /translation="MNVNQNKKVLFLTDIENGLEPILQEATNTSAENMLTIQSYGASIS
FT                   HPYGEIMRSVIFAIYQEDVEEIFVVGTKDKKTSAGNGLTQLETMKDKIQTLDYLFQNCK
FT                   PEFLGGTVDEWLNENSSDTIEKSVDMIRHHPLVPSYVKVRGLFVNHKGGKPSIAEVPDV
FT                   KTGQAMPDHCLS"
     MNVNQNKKVL FLTDIENGLE PILQEATNTS AENMLTIQSY GASISHPYGE IMRSVIFAIY        60
     QEDVEEIFVV GTKDKKTSAG NGLTQLETMK DKIQTLDYLF QNCKPEFLGG TVDEWLNENS       120
     SDTIEKSVDM IRHHPLVPSY VKVRGLFVNH KGGKPSIAEV PDVKTGQAMP DHCLS            175
//

If you have problems or comments...

PBIL Back to PBIL home page