(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCH

AL009126.YBCH        Location/Qualifiers
FT   CDS             210224..210514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="BSU_01870"
FT                   /old_locus_tag="BSU01870"
FT                   /product="conserved protein of unknown function; prophage 1
FT                   region"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11963"
FT                   /db_xref="SubtiList:BG12709"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34795"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11963.1"
FT                   /translation="MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEE
FT                   VEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY"
     MSANLTDFVT KTIEEMNSFD RENMECIKKL IRKAIDFYHL KSYEEVEETH SGNVRFLHVH        60
     SMMEENMLSK MIVVTRNGKT DLDIEGVYEG YVVREY                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page