(data stored in ACNUC7421 zone)

EMBL: AL009126.YBCM

AL009126.YBCM        Location/Qualifiers
FT   CDS             213155..213469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcM"
FT                   /locus_tag="BSU_01900"
FT                   /old_locus_tag="BSU01900"
FT                   /product="putative enzyme"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11983"
FT                   /db_xref="GOA:O31421"
FT                   /db_xref="SubtiList:BG12712"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31421"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11983.1"
FT                   /translation="MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVN
FT                   TCIISLKGLDNADDRFVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
FT                   "
     MRFLKALPRR AEVQYDCLDR TLETQENVNL NIRVNVKEVA TWGVNTCIIS LKGLDNADDR        60
     FVLPEVNTAL ALFPLSIAAD CLLMLPCISV VMSISSVMKS VTVE                        104
//

If you have problems or comments...

PBIL Back to PBIL home page