(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDG

AL009126.YBDG        Location/Qualifiers
FT   CDS             220279..221256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="BSU_01990"
FT                   /old_locus_tag="BSU01990"
FT                   /product="putative hydrolase/transferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11993"
FT                   /db_xref="GOA:O31431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG12722"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11993.2"
FT                   /translation="MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKG
FT                   TVVDVDGKKMNVYQEGSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYG
FT                   YSEVSHDDRDIDTVLEQTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIA
FT                   MDIGLPQQYVTYKLSGVDRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEI
FT                   YKAINFKQFFNADMEHELLQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNR
FT                   KDYEAFAAQFNTADIKELRGTHSIYLYQPDQIYKLSMEFMRKVR"
     MKTLWKVLKI VFVSLAALVL LVSVSVFIYH HFQLNKEAAL LKGKGTVVDV DGKKMNVYQE        60
     GSGKDTFVFM SGSGIAAPAY EMKGLYSKFS KENKIAVVDR AGYGYSEVSH DDRDIDTVLE       120
     QTRKALMKSG NKPPYILMPH SISGIEAMYW AQKYPKEIKA IIAMDIGLPQ QYVTYKLSGV       180
     DRLKVRGFHL LTSIGFHRFI PSAVYNPEVI RQSFLTDEEK EIYKAINFKQ FFNADMEHEL       240
     LQSYQNGSKS VNLPAPKETP VLILDAVSDQ NRHSKYAIQN RKDYEAFAAQ FNTADIKELR       300
     GTHSIYLYQP DQIYKLSMEF MRKVR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page