(data stored in SCRATCH zone)

EMBL: AL009126.YBDK

AL009126.YBDK        Location/Qualifiers
FT   CDS             221950..222912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="BSU_02010"
FT                   /old_locus_tag="BSU02010"
FT                   /product="two-component system sensor histidine kinase
FT                   [YbdJ]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 20035725; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11995"
FT                   /db_xref="GOA:O31433"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG12724"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 20035725"
FT                   /protein_id="CAB11995.1"
FT                   /translation="MLLFTAVISVPMLLLAVSVLMSVIYDSMFKPMNHGMPFHRSFAYP
FT                   AMIVVFLISLLLLAFLFSKSIHSLLHKINLLNQTIRHLASDQRVPDKIEVKRADEIGEL
FT                   IKSVNLLIERTTYRELELRQQEEIKKELLQKLRHDINTPLTALRLQLFYLEDQCHGQAV
FT                   FESLYQQIEYISELTNEFNLYSAETLESSYIVNEEVRLNELLETAVKKWDYLYSMSGIE
FT                   LHYKPADQDVIWMSNTLWMERLFDNIFQNTLRHSKAKKMEVTIEHGDVFIRDDGIGFDR
FT                   NESSEGLGLKIIEDTCRLLAITYELHTNDNGTGFLFSKE"
     MLLFTAVISV PMLLLAVSVL MSVIYDSMFK PMNHGMPFHR SFAYPAMIVV FLISLLLLAF        60
     LFSKSIHSLL HKINLLNQTI RHLASDQRVP DKIEVKRADE IGELIKSVNL LIERTTYREL       120
     ELRQQEEIKK ELLQKLRHDI NTPLTALRLQ LFYLEDQCHG QAVFESLYQQ IEYISELTNE       180
     FNLYSAETLE SSYIVNEEVR LNELLETAVK KWDYLYSMSG IELHYKPADQ DVIWMSNTLW       240
     MERLFDNIFQ NTLRHSKAKK MEVTIEHGDV FIRDDGIGFD RNESSEGLGL KIIEDTCRLL       300
     AITYELHTND NGTGFLFSKE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page