(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDM

AL009126.YBDM        Location/Qualifiers
FT   CDS             complement(223219..223989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="BSU_02030"
FT                   /old_locus_tag="BSU02030"
FT                   /product="putative protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 21304896; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02030"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11997"
FT                   /db_xref="GOA:O31435"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="SubtiList:BG12726"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31435"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11997.1"
FT                   /translation="MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDI
FT                   LAQTPYVLKQLRPTKAKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQF
FT                   IEGENIEELLFFRKQPFTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLC
FT                   LIDFGLAKQLTPEEMEEIKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTK
FT                   EVTLLLKRLLGIEEEYQHTASIREDLNRAIQSVT"
     MALKLLKKLL FDRPLKNGVI LNHQYKIEEC LGMGGYGLVY LCTDILAQTP YVLKQLRPTK        60
     AKKEKEKVRF QQEIKLLKNI HHPQIPGFID EFIIDGQAYY VMQFIEGENI EELLFFRKQP       120
     FTELMALQLI SQLLEIIEYL HDRLIFHSDI RTPNIIINDG RLCLIDFGLA KQLTPEEMEE       180
     IKVRKQDDFF DLGETLLFLL YSQYKGKKKK NGTWLEELTL TKEVTLLLKR LLGIEEEYQH       240
     TASIREDLNR AIQSVT                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page