(data stored in SCRATCH zone)

EMBL: AL009126.YBDN

AL009126.YBDN        Location/Qualifiers
FT   CDS             complement(224075..224932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="BSU_02040"
FT                   /old_locus_tag="BSU02040"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 16794953; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02040"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11998"
FT                   /db_xref="SubtiList:BG12727"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31436"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11998.1"
FT                   /translation="MVKKWLIQFAVMLSVLSTFTYSASAVGVTAITGNNSFDTAMPIGY
FT                   WKYKNIDTTILEAGQDEAYFTFTANKGEKVYMRSTYQSAYTGMKIEIYDKNRIPVSQGT
FT                   EVINPNTFSSFIYANADAQNTTDTFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSG
FT                   VAENKGNTSLSPSGSDSSVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHLIMTS
FT                   ENNEWSRALVNSSTSGSYDISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDV
FT                   TKQF"
     MVKKWLIQFA VMLSVLSTFT YSASAVGVTA ITGNNSFDTA MPIGYWKYKN IDTTILEAGQ        60
     DEAYFTFTAN KGEKVYMRST YQSAYTGMKI EIYDKNRIPV SQGTEVINPN TFSSFIYANA       120
     DAQNTTDTFY VKVSRGTYTG NMYFTLSIED RIKSGSGTFQ FSGVAENKGN TSLSPSGSDS       180
     SVIKVDLTNQ SGIPRDAIVT RVQTTATQTP SQGNTRHLIM TSENNEWSRA LVNSSTSGSY       240
     DISLSDQLSV AKVWSFKYNT LATARSTMSN VKAKIDYEYD VTKQF                       285
//

If you have problems or comments...

PBIL Back to PBIL home page