(data stored in ACNUC7421 zone)

EMBL: AL009126.YBDO

AL009126.YBDO        Location/Qualifiers
FT   CDS             225064..226248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="BSU_02050"
FT                   /old_locus_tag="BSU02050"
FT                   /product="putative phage protein; prophage region 1"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15033535; Product type
FT                   h: extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11999"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="SubtiList:BG12728"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31437"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11999.1"
FT                   /translation="MRLNRQFIRTQLIAQNILSKNAPAKRENATENPAAVLEKAYSRLK
FT                   SQSSTGGINQFNYSKTSVSGNSGTFSKVYQSANDRTVTDTGEETVIQSQNPYESESDIR
FT                   IKILDEKYSRMNAINKTKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFK
FT                   GKAQNYNLQDAVFRNVTFHGEVEAENEKVYQRGQVNQQLQVLLNRNHIHIPEGTELTFT
FT                   ITPIDYQVRVSGTDDQDLIKQIEQVLQSGDNSKELFLHIMKSQSSDSAQFSEEAYKKYQ
FT                   AAREMYEVTGYHLKDLEVIDGRYVTPEGRDLMDVYKEELEKDPVQKQTASYAISYYRSE
FT                   LSKIAEAGYNAIPDFILSIDYSNGSLRDVGQSKSYGTGDTGWLEALKRQTGVNY"
     MRLNRQFIRT QLIAQNILSK NAPAKRENAT ENPAAVLEKA YSRLKSQSST GGINQFNYSK        60
     TSVSGNSGTF SKVYQSANDR TVTDTGEETV IQSQNPYESE SDIRIKILDE KYSRMNAINK       120
     TKSDPLGYIK DKYQNSKSPY FRSDLSAAER QAAYDNETEW LFKGKAQNYN LQDAVFRNVT       180
     FHGEVEAENE KVYQRGQVNQ QLQVLLNRNH IHIPEGTELT FTITPIDYQV RVSGTDDQDL       240
     IKQIEQVLQS GDNSKELFLH IMKSQSSDSA QFSEEAYKKY QAAREMYEVT GYHLKDLEVI       300
     DGRYVTPEGR DLMDVYKEEL EKDPVQKQTA SYAISYYRSE LSKIAEAGYN AIPDFILSID       360
     YSNGSLRDVG QSKSYGTGDT GWLEALKRQT GVNY                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page