(data stored in SCRATCH zone)

EMBL: AL009126.YBEC

AL009126.YBEC        Location/Qualifiers
FT   CDS             231348..232967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /locus_tag="BSU_02120"
FT                   /old_locus_tag="BSU02120"
FT                   /product="putative H+/amino acid transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12006"
FT                   /db_xref="GOA:Q45577"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="SubtiList:BG12730"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45577"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12006.2"
FT                   /translation="MNQLHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISW
FT                   VIGMVVILFIALSYSELGSMFPEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEA
FT                   VASVQYMSSWPWEWAKWTSGLVKNGTLTGEGLAFASVLLLIYFLLNYWTVNLFSKANSL
FT                   ITIFKIIIPGLTIGALLFVGFHGENFTGGQSIAPNGWASVLTAVATSGIVFAFNGFQSP
FT                   INMAGEAKNPGKSIPIAVVGSLFVATVIYVLLQIAFIGAVNPSDIAHGWSHLNFNSPFA
FT                   DLAIALNINWLVIVLYADAFVSPSGTGITYTATTSRMIYGMEKNKYMPSIFGKLHPIYG
FT                   VPRQAMFFNLIVSFIFLFLFRGWGVLAEIISVATLISYITGPITVMTLRRTGKDLYRPL
FT                   RLKGLNVIAPLGFIFASLVLYWARWPLTGQVLFIILIGLPIYFYYQAKAKWKGFGRNFK
FT                   AGVWMVFYLLAMMVISYLGSDKFGGLNVIHYGWDMVLIAMVSLVFYVWALKSGYQTEYL
FT                   KDAKEINSQLLNGQSEAAAGKE"
     MNQLHRRMGT FSLMMVGLGS MIGSGWLFGA WRAAQIAGPA AIISWVIGMV VILFIALSYS        60
     ELGSMFPEAG GMVKYTQYSH GSFIGFIAGW ANWIAIVSVI PVEAVASVQY MSSWPWEWAK       120
     WTSGLVKNGT LTGEGLAFAS VLLLIYFLLN YWTVNLFSKA NSLITIFKII IPGLTIGALL       180
     FVGFHGENFT GGQSIAPNGW ASVLTAVATS GIVFAFNGFQ SPINMAGEAK NPGKSIPIAV       240
     VGSLFVATVI YVLLQIAFIG AVNPSDIAHG WSHLNFNSPF ADLAIALNIN WLVIVLYADA       300
     FVSPSGTGIT YTATTSRMIY GMEKNKYMPS IFGKLHPIYG VPRQAMFFNL IVSFIFLFLF       360
     RGWGVLAEII SVATLISYIT GPITVMTLRR TGKDLYRPLR LKGLNVIAPL GFIFASLVLY       420
     WARWPLTGQV LFIILIGLPI YFYYQAKAKW KGFGRNFKAG VWMVFYLLAM MVISYLGSDK       480
     FGGLNVIHYG WDMVLIAMVS LVFYVWALKS GYQTEYLKDA KEINSQLLNG QSEAAAGKE        539
//

If you have problems or comments...

PBIL Back to PBIL home page