(data stored in SCRATCH zone)

EMBL: AL009126.YBEF

AL009126.YBEF        Location/Qualifiers
FT   CDS             235625..235873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="BSU_02150"
FT                   /old_locus_tag="BSU02150"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12009"
FT                   /db_xref="GOA:O31442"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="SubtiList:BG12731"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31442"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12009.1"
FT                   /translation="MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTF
FT                   TIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN"
     MDELDIAFFI LPLGIMLLSI VGTCICKNPY LMPMLSLVIS LVLTFTIFNQ SFLGWAVVYS        60
     LVSLALSYIT LIVVRKRKES GN                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page