(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFA

AL009126.YBFA        Location/Qualifiers
FT   CDS             235965..236882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="BSU_02160"
FT                   /old_locus_tag="BSU02160"
FT                   /product="putative transcriptional regulator with
FT                   acetyltransferase domain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02160"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12010"
FT                   /db_xref="GOA:O31443"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="SubtiList:BG12732"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31443"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12010.1"
FT                   /translation="MKTRESSVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IYNTPNCTAKALQDKLGLDRGYVSRIVKQFEKEDLIYKQRSKDDARHHYIFVTETGKTI
FT                   YKKLEEKANEQVELMLKVINQKEQHKLAEAMAEIEAILSQSLSARASEISIRDYFLSED
FT                   LQLLIEKQRQFYAEAHGWDDTFLAYLQETFDADIEKIWIAESGGKFAGSVGLVKHDEKT
FT                   VQLRWFLVDADFRGRGLGTQLLEHLVAYCQDMKFDRIFLWTVSTMAEARPLYKKFGFRI
FT                   SEVKQEAPLWGQQLTEERWDLELS"
     MKTRESSVGL KFRKFNRFYT NVLGFLNEHI YDSPFSLTET RILFEIYNTP NCTAKALQDK        60
     LGLDRGYVSR IVKQFEKEDL IYKQRSKDDA RHHYIFVTET GKTIYKKLEE KANEQVELML       120
     KVINQKEQHK LAEAMAEIEA ILSQSLSARA SEISIRDYFL SEDLQLLIEK QRQFYAEAHG       180
     WDDTFLAYLQ ETFDADIEKI WIAESGGKFA GSVGLVKHDE KTVQLRWFLV DADFRGRGLG       240
     TQLLEHLVAY CQDMKFDRIF LWTVSTMAEA RPLYKKFGFR ISEVKQEAPL WGQQLTEERW       300
     DLELS                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page