(data stored in SCRATCH zone)

EMBL: AL009126.YBFF

AL009126.YBFF        Location/Qualifiers
FT   CDS             complement(238644..239555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="BSU_02190"
FT                   /old_locus_tag="BSU02190"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12013"
FT                   /db_xref="GOA:O31446"
FT                   /db_xref="SubtiList:BG12735"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31446"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12013.1"
FT                   /translation="MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHY
FT                   YSEPSLPLQFLVKVAVLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIF
FT                   MTYTKIIKKGNKNKGKASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNED
FT                   SMNFSAVLNHVLTISKNDKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSI
FT                   IVVYATSLFSGQINYIDIPHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRA
FT                   EYLRMRGVIDFILTERYNKKIM"
     MKNDQIVFEK TKNIAHDINQ MQNQQEIIDY LFRQDSLTLN QLKHYYSEPS LPLQFLVKVA        60
     VLCMFISMTL ASFLFIQAKE VFTNTILSDI SPAVFSIFTV ICIFMTYTKI IKKGNKNKGK       120
     ASLNQRSEFY EKNKLINTIL YKKYKMDQQN IQANKHTASD NEDSMNFSAV LNHVLTISKN       180
     DKELLGYLDT RDNAMLSQLK AYFSTRPFSL PHYMSLMFCG SIIVVYATSL FSGQINYIDI       240
     PHIFIFLLLI IFLKILIDLI KLLNISRKGQ LHTVLHFAQR AEYLRMRGVI DFILTERYNK       300
     KIM                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page