(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFG

AL009126.YBFG        Location/Qualifiers
FT   CDS             complement(239644..241842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /locus_tag="BSU_02200"
FT                   /old_locus_tag="BSU02200"
FT                   /product="putative pepdidoglycan binding protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12014"
FT                   /db_xref="GOA:O31447"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="SubtiList:BG12736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31447"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12014.1"
FT                   /translation="MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQ
FT                   IELGISEPADNFGPTTQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYE
FT                   KTENAVKEFQKAAGLTTQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYND
FT                   YIGLMPCDGLYGRDTNKALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFV
FT                   LIVQYALYCNGKSFDPGEFDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSG
FT                   DTTRTASACDTATIITAEKAQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVIL
FT                   DAGLKVFPIYQDGGYESSYFVKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYE
FT                   VTDKIIPYFQEIKSAFTKMQTFSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTG
FT                   FSGNLGYPMPNNWAFDQFYEGTIGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARL
FT                   RTLTDILSTIPALENLTSLANAMFEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTI
FT                   TITNGKPGAYITGLLGDTQTSLTASQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNI
FT                   QIKIYTPDIPVGDNVTTGLTTTITFKIKTYKGVPVTSPESELALDWPSYDQYLFPVVGV
FT                   AALLLIGNMGSDLTNNKGVKVATALSAMLLAIFAYYTS"
     MVDEMVLITQ QWLNDTYSGK HGYNPVEESG KTGWDTIYGL TRALQIELGI SEPADNFGPT        60
     TQRLFKPLKR QAPDSKPSNM NFILQGALWC KGFNPGGFTG VFYEKTENAV KEFQKAAGLT       120
     TQDGIVTTLI MKALLDMSAF KLVSGGDSRI RQIQQNLNRD YNDYIGLMPC DGLYGRDTNK       180
     ALIYALQKEE GMSTSVANGF FGNGTTSLCP TLTPGDSRTG FVLIVQYALY CNGKSFDPGE       240
     FDGKYGVGVV SAVKAFQEFM CLPQTGYADM PTIKALLSSS GDTTRTASAC DTATIITAEK       300
     AQTLRNNGYK TVGRYLTGNV RTSSGLTSKA LTSKELAVIL DAGLKVFPIY QDGGYESSYF       360
     VKDQGTRDAY SAASAARRLG FPSGTTIYFA VDFDAYDYEV TDKIIPYFQE IKSAFTKMQT       420
     FSTAPKYEIG VYGPRNICIR TSEAGLTKYS FVANMSTGFS GNLGYPMPNN WAFDQFYEGT       480
     IGSGSGSIGI DKDGYSGRDS GASNVNPPSD PVYDARLRTL TDILSTIPAL ENLTSLANAM       540
     FEFDTTETIF TSPELDIILS TSLLATIPSE GSPNTITITN GKPGAYITGL LGDTQTSLTA       600
     SQIDSYQNLL NSLSLSVRNG YLEVYVNPTA ESLNIQIKIY TPDIPVGDNV TTGLTTTITF       660
     KIKTYKGVPV TSPESELALD WPSYDQYLFP VVGVAALLLI GNMGSDLTNN KGVKVATALS       720
     AMLLAIFAYY TS                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page