(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFM

AL009126.YBFM        Location/Qualifiers
FT   CDS             248268..248756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="BSU_02280"
FT                   /old_locus_tag="BSU02280"
FT                   /product="putative membrane phosphatase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12682299, 14762009,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12022"
FT                   /db_xref="GOA:O31453"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="SubtiList:BG12741"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31453"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12022.1"
FT                   /translation="MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTD
FT                   VLNYELSILISFVGALLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYG
FT                   PYSLILGYFIPGVRHVTCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV"
     MELVQQLIAD YGYLAIFLML VLGIVGLPIP DEVMMTVVGY FTHTDVLNYE LSILISFVGA        60
     LLGMLISYMI GRKAGRPFID KYGKWVGLKE KRMMKVEKWM KKYGPYSLIL GYFIPGVRHV       120
     TCYFSGIGKM DLKTYVAFAA IGAFLWCFVF ITIGRVIGII HV                          162
//

If you have problems or comments...

PBIL Back to PBIL home page