(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFN

AL009126.YBFN        Location/Qualifiers
FT   CDS             249595..249873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="BSU_02300"
FT                   /old_locus_tag="BSU02300"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12024"
FT                   /db_xref="SubtiList:BG12742"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31454"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12024.1"
FT                   /translation="MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQ
FT                   ANNLREKGIERFPFIISKYQADVQLPVETFLQNTYRFYFHQVMRESS"
     MEKQIISWIT DYQNTGDEAV LRQVREVCWP IVEAVLQEKV MDDEQANNLR EKGIERFPFI        60
     ISKYQADVQL PVETFLQNTY RFYFHQVMRE SS                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page