(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFO

AL009126.YBFO        Location/Qualifiers
FT   CDS             249979..251319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /locus_tag="BSU_02310"
FT                   /old_locus_tag="BSU02310"
FT                   /product="putative exported hydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12025"
FT                   /db_xref="GOA:O31455"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="SubtiList:BG12743"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31455"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12025.1"
FT                   /translation="MKRMIVRMTLPLLIVCLAFSSFSASARAASEEKYWDHWIERHAQP
FT                   LDASNASNKDLRFLKKVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFE
FT                   SGFPDTNASYLNMDQLTPKSTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDI
FT                   QSMKNSFNVAATQWVKAVDPEKAELLSQSENDFSTLVTDSNTFDEFSQKKEKLVKNYQK
FT                   LIKFTKTHASELKENLPKEPKAYEMFMHSLQLRIDVMETYMLEEMKEKLEEYPENIEDF
FT                   SFFMRDRMMAEQFQWVADTLYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLP
FT                   ERLKKQTYTIGIYAYSGASLDSSDNKTVKPVTSPPPSGSLEALLKAADRPAVFVDFLHT
FT                   KNKKGTSWMYTPRTALYWGYMEEQMILKEQYDGVIWLEHITPSVIIK"
     MKRMIVRMTL PLLIVCLAFS SFSASARAAS EEKYWDHWIE RHAQPLDASN ASNKDLRFLK        60
     KVLKGKRIVQ LGETTHGAGE INATKVRMIK YLHEELGYDV LAFESGFPDT NASYLNMDQL       120
     TPKSTMKNSI YAVWHTEDVV ELFDYMKEQK EKGDPLILTG FDIQSMKNSF NVAATQWVKA       180
     VDPEKAELLS QSENDFSTLV TDSNTFDEFS QKKEKLVKNY QKLIKFTKTH ASELKENLPK       240
     EPKAYEMFMH SLQLRIDVME TYMLEEMKEK LEEYPENIED FSFFMRDRMM AEQFQWVADT       300
     LYPKKKIIVW GHNYHLRKQN TKMIKDWVQL NGPNMGDYLP ERLKKQTYTI GIYAYSGASL       360
     DSSDNKTVKP VTSPPPSGSL EALLKAADRP AVFVDFLHTK NKKGTSWMYT PRTALYWGYM       420
     EEQMILKEQY DGVIWLEHIT PSVIIK                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page