(data stored in ACNUC7421 zone)

EMBL: AL009126.YBFQ

AL009126.YBFQ        Location/Qualifiers
FT   CDS             252514..253482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /locus_tag="BSU_02330"
FT                   /old_locus_tag="BSU02330"
FT                   /product="putative enzyme with rhodanese domain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10939241, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12027"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="SubtiList:BG12745"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31457"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12027.1"
FT                   /translation="MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEG
FT                   INGTVSGTVEQTEKYMETMKADPRFADMVFKIDEAEGHAFKKIFVRHKKELVTLRLEDD
FT                   VDPNETTGQHLKPAEFYEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWI
FT                   EEHKDMLEGKKILTYCTGGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMR
FT                   SCSHECRTNPRNLYVKEHNMTEEEVNARLAAIETEDHAAAE"
     MEKQYRVLLY YKYVPIEDPE AFREQHLAFC KELGLLGRIL VSSEGINGTV SGTVEQTEKY        60
     METMKADPRF ADMVFKIDEA EGHAFKKIFV RHKKELVTLR LEDDVDPNET TGQHLKPAEF       120
     YEKMQDPNTI VIDARNDYEY DLGHFRGAVR PDIEAFRELP EWIEEHKDML EGKKILTYCT       180
     GGVRCEKFSG WLVKQGFEDV AQLDGGIVTY GKDPEVQGKL WDGQCYVFDE RISVPVNRVE       240
     HVIVGKDYFT GEPCERYVNC ANPSCNKKMI CTPENEYKYM RSCSHECRTN PRNLYVKEHN       300
     MTEEEVNARL AAIETEDHAA AE                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page