(data stored in SCRATCH zone)

EMBL: AL009126.YBGB

AL009126.YBGB        Location/Qualifiers
FT   CDS             258532..258807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /locus_tag="BSU_02380"
FT                   /old_locus_tag="BSU02380"
FT                   /product="conserved protein of unknown function (B.
FT                   subtilis-specific)"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 12897008, 23667565"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12032"
FT                   /db_xref="GOA:O31460"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="SubtiList:BG12748"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31460"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12032.1"
FT                   /translation="MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLT
FT                   VNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL"
     MFLFTNGKVL WGAVIAAFIL SIVFYPFLPT QMPIHYDVAN SPDLTVNKLA GTVMLPVLMV        60
     VFAWARKINW QFVFAVYILL ICHIVVLCLA L                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page