(data stored in ACNUC7421 zone)

EMBL: AL009126.YBGG

AL009126.YBGG        Location/Qualifiers
FT   CDS             complement(261656..262603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /locus_tag="BSU_02410"
FT                   /old_locus_tag="BSU02410"
FT                   /product="homocysteine methylase using (R,S)AdoMet"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.10"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11267663, 15995196, 17264075;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12035"
FT                   /db_xref="GOA:O31463"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="SubtiList:BG12751"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31463"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12035.1"
FT                   /translation="MNPIQHILDTYPLIVLDGAMATELERKGCNLNDSLWSAKILMEEP
FT                   ELIKQVHTDYFAAGADCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFW
FT                   SLEENRLNRPKPIIAASIGPYGAYLADGSEYRGNYAISEDELIEFHRPRMKALIEAGAD
FT                   VLACETIPCLTEAKAIVRLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHRQI
FT                   AALGINCTPLQHIPSLIEELKKNTSKPIIVYPNSGEQYDPETKTWNGAACAESYGASAR
FT                   TWHEKGARLIGGCCRTKPENIQEIAAWARSLKTT"
     MNPIQHILDT YPLIVLDGAM ATELERKGCN LNDSLWSAKI LMEEPELIKQ VHTDYFAAGA        60
     DCAITASYQS TFEGFAARGL SEAEARRLIE LSVSIAAEAR DEFWSLEENR LNRPKPIIAA       120
     SIGPYGAYLA DGSEYRGNYA ISEDELIEFH RPRMKALIEA GADVLACETI PCLTEAKAIV       180
     RLLKEFPETY AWISFSAKDG LHISDGTPAA DCASWLDEHR QIAALGINCT PLQHIPSLIE       240
     ELKKNTSKPI IVYPNSGEQY DPETKTWNGA ACAESYGASA RTWHEKGARL IGGCCRTKPE       300
     NIQEIAAWAR SLKTT                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page