(data stored in ACNUC7421 zone)

EMBL: AL009126.YBXG

AL009126.YBXG        Location/Qualifiers
FT   CDS             226566..227954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxG"
FT                   /locus_tag="BSU_02060"
FT                   /old_locus_tag="BSU02060"
FT                   /product="putative amino acid permease"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12000"
FT                   /db_xref="GOA:P54425"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="SubtiList:BG11505"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12000.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMS
FT                   EIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGIGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIG
FT                   LAVGVVLNYIAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFA
FT                   PFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSE
FT                   QAAE"
     MANKELKRGL GARHIQMIAL GGTIGVGLFM GSASTISWTG PSVLLAYAIC GIFIFFIMRA        60
     MGEMLYVEPS TGSFATFGHQ YIHPMAGYIT AWSNWFQWII VGMSEIIAVG SYTKYWFPDL       120
     PAWIPGIVAM VILGAANLIS VKSFGEFEFW FAMIKIVTII LMIIAGIGII FFGFGNGGDA       180
     IGLSNLWSHG GFFAGGFSGF FFALSLVIAA YQGVELIGIT AGEAKDPQNT LRNAIQSIIW       240
     RILIFYIGAI FVIVTVYPWD ELNSLGSPFV STFSKIGITA AAGIINFVVI TAAMSGCNSG       300
     IFSAGRMLYT LGVNGQAPKF FKKISRNGVP LYGTIAVLIG LAVGVVLNYI APPKIFVYVY       360
     SASVLPGMIP WFIILISHIG FRKAKGAALD KHPFKMPFAP FTNYLTIAFL LMVLVGMWFN       420
     DDTRISLIVG VIFLALVVIS YYVFGIGKRT QANLTKSEQA AE                          462
//

If you have problems or comments...

PBIL Back to PBIL home page