(data stored in SCRATCH zone)

EMBL: AL009126.YBXH

AL009126.YBXH        Location/Qualifiers
FT   CDS             228331..228522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxH"
FT                   /locus_tag="BSU_02080"
FT                   /old_locus_tag="BSU02080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02080"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12002"
FT                   /db_xref="InterPro:IPR035314"
FT                   /db_xref="SubtiList:BG11506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54426"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12002.1"
FT                   /translation="MGAIERSGYTFQPEFSVVRQNGAIHVYHQGEFVEEIEFEFNGEYP
FT                   DHDLIEELVNHYCFEHEI"
     MGAIERSGYT FQPEFSVVRQ NGAIHVYHQG EFVEEIEFEF NGEYPDHDLI EELVNHYCFE        60
     HEI                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page