(data stored in SCRATCH zone)

EMBL: AL009126.YBXI

AL009126.YBXI        Location/Qualifiers
FT   CDS             complement(228549..229352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxI"
FT                   /locus_tag="BSU_02090"
FT                   /old_locus_tag="BSU02090"
FT                   /product="exported beta-lactamase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14742199; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12003"
FT                   /db_xref="GOA:P54427"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:5E2F"
FT                   /db_xref="SubtiList:BG11507"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14742199"
FT                   /protein_id="CAB12003.1"
FT                   /translation="MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKD
FT                   TDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGV
FT                   KREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFW
FT                   LQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDM
FT                   GLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS"
     MKKWIYVVLV LSIAGIGGFS VHAASSAHEK HLNVSKMNVD DEFKDTDGTF ILHDLQKDQT        60
     FVYNRKRANQ RQTPQSTFKV VNALIGLQVK AVRDEYDVKR WDGVKREFES WNRDHTLGSA       120
     MRESAIWYYQ ALARDIGEER MKTWLHTLSY GNEDISGGID QFWLQSSLTI SPLEQETFLE       180
     KLAKEELPFD KPVMKIVKRM MIQEEGDHYT LYGKTGTRLT DMGLGWFVGF IKTEHGSYVF       240
     VTNVDDSGTK AKNITVDILK KYGLITS                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page