(data stored in SCRATCH zone)

EMBL: AL009126.YBZI

AL009126.YBZI        Location/Qualifiers
FT   CDS             222971..223234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybzI"
FT                   /locus_tag="BSU_02019"
FT                   /old_locus_tag="BSU02019"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02019"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52542"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52542.1"
FT                   /translation="MNIICLKKSSKRLSTSQAVLVTDIADTGITAAAGADIIAATAAVR
FT                   AKEDTTTVMAAVIVTNAGATAAVNPKKVLVPLLGQGFFYVTD"
     MNIICLKKSS KRLSTSQAVL VTDIADTGIT AAAGADIIAA TAAVRAKEDT TTVMAAVIVT        60
     NAGATAAVNP KKVLVPLLGQ GFFYVTD                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page