(data stored in SCRATCH zone)

EMBL: AL009126.YCBJ

AL009126.YCBJ        Location/Qualifiers
FT   CDS             275838..276758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbJ"
FT                   /locus_tag="BSU_02520"
FT                   /old_locus_tag="BSU02520"
FT                   /product="putative phosphotransferase"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12046"
FT                   /db_xref="GOA:P42242"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="SubtiList:BG11165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42242"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12046.1"
FT                   /translation="MTNLNEKQLITEIVGLARSQGLTVHSENAQLNETGMDFQVVFAKD
FT                   DTGMPWVLRKPRRSDVVERASAEGITLAFLRANLTADVPDWRIHTPELIAYPMLKGTPA
FT                   AGIDLEQKQYVWNMDHQPPSDDFVRTLADILAELHGTDQISAGQSGIEVIRPEDFRQMT
FT                   ADSMVDVKNKLGVSTTLWERWQKWVDDDAYWPGFSSLIHGDLHPPHILIDQNGRVTGLL
FT                   DWTEAKVADPAKDFVLYQTIFGEKETARLLEYYDQAGGRIWAKMQEHISEMQAAYPVEI
FT                   AKLALQTQQEEHINMALEALGVTSD"
     MTNLNEKQLI TEIVGLARSQ GLTVHSENAQ LNETGMDFQV VFAKDDTGMP WVLRKPRRSD        60
     VVERASAEGI TLAFLRANLT ADVPDWRIHT PELIAYPMLK GTPAAGIDLE QKQYVWNMDH       120
     QPPSDDFVRT LADILAELHG TDQISAGQSG IEVIRPEDFR QMTADSMVDV KNKLGVSTTL       180
     WERWQKWVDD DAYWPGFSSL IHGDLHPPHI LIDQNGRVTG LLDWTEAKVA DPAKDFVLYQ       240
     TIFGEKETAR LLEYYDQAGG RIWAKMQEHI SEMQAAYPVE IAKLALQTQQ EEHINMALEA       300
     LGVTSD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page